PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_158099g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 448aa    MW: 50605.2 Da    PI: 5.5474
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_158099g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W+++Ede+l+++++++G g+W+ ++++ g+ R++k+c++rw +yl
   MA_158099g0010 14 RGLWSPDEDEKLINYITKYGYGCWSEVPEKSGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding50.83.7e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++ E++l+++++++ G++ W+ Ia++++ gRt++++k++w+++
   MA_158099g0010  67 RGNFSPNEEKLIIHLHTMVGNR-WAYIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-25664IPR009057Homeodomain-like
PROSITE profilePS5129423.88965IPR017930Myb domain
SuperFamilySSF466892.13E-2911108IPR009057Homeodomain-like
SMARTSM007175.2E-121363IPR001005SANT/Myb domain
PfamPF002493.1E-141461IPR001005SANT/Myb domain
CDDcd001679.21E-111761No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2465116IPR009057Homeodomain-like
SMARTSM007173.1E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.39966116IPR017930Myb domain
PfamPF002497.9E-1467111IPR001005SANT/Myb domain
CDDcd001673.89E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MGRHLCCNQQ KVKRGLWSPD EDEKLINYIT KYGYGCWSEV PEKSGLQRCG KSCRLRWINY  60
LRPDIRRGNF SPNEEKLIIH LHTMVGNRWA YIASHLPGRT DNEIKNYWNS WIKKKLAKAE  120
IISKNIEASK VHNNLPQFLF EQSATRDNDC KLLKTEMTTD GHAAPLSHVL PSKENSETFP  180
LWDYKMINPS TTRNSLYGIE ESKAALTFDS LLIRTDSETG AIKELNTWDP SGILINSSSK  240
NCKNSDLQYA LQRDNGLQVQ GLPASSTWHG YSSLNPIESS FCYNPNSENS NGLHSTSSMN  300
ESDFMRSMDM APLIYSQHET LDLADHANVA TMWASGSSSN GVDLGYSECL YSAEQYNHGT  360
ENSCGYLPPL YDASEESAAI NIKHNENNSL RYLEQIQSNE INIAQEMDAI QQIFECGEQN  420
SNLVTTIQYC LGSHSPVSDS HHPQDTFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-26141167108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6010650.0EF601065.1 Picea glauca R2R3-MYB transcription factor MYB2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA5JYE60.0A5JYE6_PICGL; R2R3-MYB transcription factor MYB2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.14e-74myb domain protein 103